Información

¿Cuáles son los diferentes tipos de hélices en las estructuras secundarias de las proteínas y en qué se diferencian?

¿Cuáles son los diferentes tipos de hélices en las estructuras secundarias de las proteínas y en qué se diferencian?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

¿Cuáles son los diferentes tipos de hélices en las estructuras secundarias de las proteínas y cómo se diferencian?

En los documentos de DSSP, los tipos de hélices mencionados son: Alpha-Helix, Helix-3 y Helix-5.

En los documentos de STRIDE, los tipos de hélices mencionados son: Alpha-Helix, 3-10 Helix, PI-Helix.

¿Por qué DSSP tiene Helix-3 y Helix-5, mientras que STRIDE tiene 3-10 Helix y PI-Helix? ¿Son expresiones diferentes para lo mismo?

¿Cuáles son las diferencias entre estos tipos de hélices, cuáles son sus nombres científicos completos para que pueda leer más sobre ellos, y hay otros tipos de hélices que no se mencionan aquí?


Esta página de DSSP deja en claro que:

Hélice-3 = 3-10 hélice

Hélice-5 = π-hélice

los α-hélice se describe en todos los libros de texto de bioquímica y ampliamente en la web. Tiene 3.6 residuos por vuelta helicoidal y tiene 13 átomos en el anillo formado por el enlace de hidrógeno, por lo que también se puede llamar una hélice 3.6-13.

los 3-10 hélice es menos común que la hélice α, pero todavía está muy extendida. Por analogía con la nomenclatura alternativa que se acaba de describir para la hélice α, tiene 3 residuos por giro helicoidal en un anillo de 10 átomos.

los π-hélice es incluso menos común. Es una hélice más ancha con 4,6 residuos por vuelta.

Se puede encontrar una comparación de los tres en este artículo de proteopedia, del cual he tomado la siguiente ilustración.

También está el triple hélice de colágeno, pero eso es específico del colágeno, mientras que los otros son ejemplos generales de estructura secundaria que se encuentran en muchas proteínas.

Nomenclatura estándar

No existe un "nombre científico completo" en esta área de la biología molecular. Los nombres tienden a estandarizarse mediante acuerdos no oficiales cuando la ambigüedad se convierte en un problema. Las hélices distintas de la α-hélice no son muy conocidas, pero los términos 3-10 hélice y π-hélice son ciertamente más comunes que Helix-3 y Helix-5, lo que sospecho que puede haber sido una conveniencia computacional. Sin embargo, una búsqueda en Internet indica que para las revistas científicas 310-hélice generalmente se prefiere a 3-10 hélices o 3 (10) hélices, estas últimas tal vez reflejen el trabajo en un entorno de texto plano o las limitaciones de procesamiento de texto o HTML de los escritores.


La vuelta del tornillo: un ejercicio de estructura secundaria de proteínas

Se presenta un ejercicio que utiliza tiras de papel simples para ilustrar las estructuras secundarias en láminas y helicoidales de proteínas. Basándose en el rico contexto histórico del uso de modelos físicos en la bioquímica de proteínas por parte de los primeros practicantes, en particular Linus Pauling, el propósito de esta actividad es cultivar en los estudiantes un sentido práctico e intuitivo de la estructura secundaria de las proteínas y complementar los conceptos comunes. Representaciones estructurales basadas en computadora que se utilizan a menudo en la enseñanza de la bioquímica. A medida que los estudiantes doblan estas tiras de papel en estructuras secundarias modelo, comprenderán mejor cómo se forman los enlaces de hidrógeno intramoleculares en el plegado de un polipéptido en una estructura secundaria, y cómo estos enlaces de hidrógeno dirigen la forma general de las estructuras helicoidales y laminares, incluida la destreza de los α-helix y la diferencia entre giro a la derecha y a la izquierda. EDUCACIÓN EN BIOQUÍMICA Y BIOLOGÍA MOLECULAR Vol. 39, núm. 3, págs. 221–225, 2011.

Uno de los placeres de la bioquímica es la forma en que los patrones simples de formas repetidos una y otra vez pueden extenderse, crecer y emerger en la complejidad de la vida. Tecnologías como Jmol [1] y otros visores de estructuras brindan acceso casi instantáneo a representaciones interactivas de estructuras macromoleculares en la mayor cantidad de gloria de alta definición, alta resolución, zoom y giro que la tarjeta gráfica del usuario y el ancho de banda pueden admitir. . La capacidad de llevar videos de juegos a la computadora portátil de un estudiante es un gancho atractivo para el estudio de las estructuras de proteínas y ácidos nucleicos.

Sin embargo, antes de Jmol y sus antepasados, como Chime y Rasmol, los visores de estructuras moleculares consistían en modelos físicos cuidadosamente elaborados. A medida que el trabajo de los cristalógrafos avanzaba hacia macromoléculas cada vez más grandes, los que trabajaban en el campo incipiente de la biología estructural necesitaban alguna forma de visualizar sus sujetos moleculares en tres dimensiones. Los más visionarios de ellos, parejas como John Kendrew y Max Perutz, Linus Pauling y Robert Corey, y James Watson y Francis Crick, se volvieron hacia modelos de madera y metal de palo o bola y palo. Probablemente, el más famoso es el que se conserva en la fotografía de Watson y Crick mirando su modelo de doble hélice; una búsqueda de imágenes en Google de Watson y Crick lo sacará. Desde bolas de madera y tornillos de metal en la década de 1950 hasta los modernos de plástico (más coloridos y convenientemente más flexibles), los modelos moleculares apelan a la intuición táctil, visual y espacial de una manera verdaderamente práctica que un mouse de computadora no puede, y sigue siendo una característica única. una forma estética y funcional de, literalmente, captar las estructuras de proteínas y ácidos nucleicos.

Al enseñar estructura secundaria de proteínas, a menudo hago que los estudiantes preparen aminoácidos modelo utilizando modelos moleculares "Darling" (que se usan en nuestro curso de química orgánica, por lo que son familiares para mis clases de bioquímica) y luego los unen a través de enlaces amida en polipéptidos, doblándolos en estructuras de láminas plisadas en α-hélice y β. Sin embargo, hay una gran cantidad de rotación de enlace posible involucrada, y la conexión entre un conjunto dado de ángulos de enlace Φ y Ψ no siempre es inmediata. En relación tanto con el modelado por computadora como con los modelos moleculares, el plegado de papel estilo origami para visualizar la estructura de las proteínas es instructivo y accesible (y barato). También tiene un precedente histórico en el descubrimiento de estructuras proteicas. En 1948, Linus Pauling, habiendo establecido su carrera en química física en Cal Tech, había centrado su atención en las moléculas biológicas y pasaba un año como profesor invitado en Oxford, Inglaterra. Como podría esperarse de un californiano en Inglaterra, parece que contrajo un fuerte resfriado y pasó unos días en la cama. Pauling relató que, aburrido durante su recuperación, comenzó a pensar y esbozar estructuras polipeptídicas probables basadas en la suposición de un enlace trans-amida planar que une aminoácidos individuales configurados de manera idéntica, con el objetivo de explicar el enlace de hidrógeno completo entre el hidrógeno amida. y átomos de oxígeno [2]. Los artículos de Pauling alojados en la Universidad Estatal de Oregon incluyen una copia de uno de sus bocetos, con instrucciones para hacer girar el papel en espiral para unir cada átomo de hidrógeno de amida al átomo de oxígeno de amida del aminoácido a cuatro residuos de distancia, en lo que ahora llamaríamos una hélice α [3].

Quería usar una copia del boceto de Pauling como ejercicio de clase como introducción al plegamiento de proteínas, pero descubrí que el boceto producía, cada vez y, finalmente, de manera bastante frustrante, una hélice para zurdos. Una hélice para zurdos es aquella que está opuesta en giro a un tornillo convencional "apretado a la derecha". Una comparación del boceto de Pauling plegado con una imagen de una hélice α de proteína de cualquier libro de texto de bioquímica confirmará que el boceto de Pauling es la imagen especular de la hélice de proteína convencional.

¿Pauling se equivocó en este? Parece que lo hizo, que el boceto archivado en la Universidad Estatal de Oregon no está alterado de manera anómala en relación con el pensamiento de Pauling en ese momento, sino que es coherente con la forma en que imaginó la hélice. La inspiración de Pauling en la cama de enfermo fue parte de una colaboración en curso que tuvo con Robert Corey sobre la estructura de las proteínas basada en datos cristalográficos. Su trabajo vio la luz en una serie de siete artículos consecutivos en el número del 15 de mayo de 1951 de las Actas de la Academia Nacional de Ciencias (PNAS). La serie de artículos y un resumen de su historia y contexto han sido publicados en línea por PNAS [4]. El primer artículo [5] describe los parámetros cristalográficos esperados de la hélice α (a la que llamaron la hélice de 3.7 residuos) así como la hélice π (entonces llamada hélice de 5.1 residuos), pero no hace distinciones entre la hélice izquierda - y versiones para diestros de cada uno. El segundo artículo [6] presenta estructuras de varios polipéptidos homopoliméricos sintéticos con conclusiones basadas en la simetría de las células unitarias cristalográficas y la longitud de repetición que favorece la hélice α, pero sin comentarios sobre la lateralidad de la hélice. De hecho, tanto las hélices π como las α se ilustran en sus versiones para zurdos.

El tercer artículo [7] presenta la estructura de la hoja plisada β de la proteína de seda, donde la mano no es un problema. Los artículos cuarto y quinto [8, 9] se centran en las queratinas, que se deduce correctamente que son de naturaleza α-helicoidal, y cada descripción de estas hélices es para zurdos. El sexto [10] presenta la triple hélice de colágeno enrollada en espiral, que de hecho es zurda y se describe en el artículo de PNAS como tal. El séptimo artículo [11] trata de la estructura de la hemoglobina, argumentando con precisión a favor de un contenido altamente β-helicoidal pero evasivo en cuanto a la lateralidad.

Pauling y Corey parecían haber considerado la posibilidad de cualquier sentido helicoidal. En un artículo publicado, también en PNAS, unos meses antes de la obra maestra de siete en fila, los dos, con Harvey Branson, publicaron detalles de la hélice α / 3.7 y la hélice π / 5.1 basados ​​únicamente en la geometría de el enlace peptídico, que muestra la hélice α con un giro a la izquierda y la hélice π con un giro a la derecha. Son sorprendentemente uno al lado del otro en las figuras dos y tres de este documento, tan diferentes como los pedales de una bicicleta izquierda y derecha, pero no se hace ningún comentario sobre la diferencia. La ambigüedad helicoidal de las representaciones de las hélices α de Pauling y Corey parece no haber suscitado muchos comentarios desde 1951, de hecho, solo he encontrado una publicación que lo comenta, en un ensayo de Jack Dunitz en Angewante Chemie [12]. Dunitz observa la rotación a la izquierda de la hélice α que se muestra en el artículo de abril de PNAS de Pauling, Corey y Branson, y señala que la torsión de las hélices presentadas, así como la estereoquímica absoluta de los propios aminoácidos, se asignaron arbitrariamente. . En 1951, la capacidad de asignar de manera inequívoca la estereoquímica absoluta recién estaba apareciendo en escena. Antes de este tiempo, la estereoquímica era accesible solo de forma relativa. Las reglas de Fisher distinguían los carbohidratos D y L (y, por extensión, los aminoácidos), pero qué enantiómero de, digamos, glucosa o alanina, era cuál en términos de lo que los estudiantes de química orgánica de hoy aprenden como la convención R / S Cahn-Ingold-Prelog no se pudo determinar. Dunitz señala que alrededor de 1950, de hecho, los químicos habían descubierto cómo usar la cristalografía para determinar la estereoquímica absoluta, pero esto era una noticia de última hora en ese momento. Concluye que "Pauling no estaba al tanto de estos desarrollos cuando escribió el artículo de la hélice α o los conocía pero no estaba interesado".

Dada la curiosidad intelectual innata de Pauling, parece difícil creer que no hubiera pensado en la cuestión del giro helicoidal, y sospecho que él y Corey simplemente estaban cubriendo sus apuestas. Esto probablemente fue prudente, ya que no fue hasta más de 10 años después que el análisis cuidadoso de los ángulos de enlace de los aminoácidos por Ramachandran mostró cómo la conformación local de los ángulos Φ y Ψ de un aminoácido individual conduce a la preferencia de los ángulos de la mano derecha sobre la izquierda. hélices polipeptídicas entregadas la diferencia es bastante sutil.

Mi intención inicial con este artículo fue simplemente compartir un ejercicio sobre el plegamiento de proteínas que me ha resultado útil, pero el desvío tomado a través de la estereoquímica aquí es un viaje que vale la pena para los estudiantes de bioquímica de pregrado. Si bien poner las herramientas modernas de interacción entre proteínas y estructuras de ácidos nucleicos en las manos de los estudiantes (o computadoras) es emocionante y efectivo, es útil alejarse de las estructuras en todo su colorido esplendor y recordar que estas existen solo debido a la creatividad. y el arduo trabajo de muchos científicos a lo largo de los años. También es un buen recordatorio de que, ahora como en 1951, nuestras descripciones de las moléculas son interpretaciones, incompletas y siempre sujetas a revisión.

Los modelos de papel presentados aquí facilitan una investigación sobre las formas en que una matriz de residuos de aminoácidos configurados uniformemente en una cadena polipeptídica puede ensamblarse en estructuras helicoidales o planas de una manera que permite que los átomos de hidrógeno y oxígeno de amida formen enlaces de hidrógeno péptido-péptido . Esta investigación proporciona una experiencia de aprendizaje activa que se puede colocar en un curso de lectura tradicional o como parte de un formato de curso no tradicional. Es flexible al adaptarse a un entorno individual o cooperativo / colaborativo. Asume un conocimiento básico de química orgánica, incluida la familiaridad con el grupo funcional amida y con la estereoquímica, como se aprendería en un curso orgánico típico de pregrado.


Tipos de 20 aminoácidos y sus estructuras.

Cada uno de los 20 aminoácidos tiene el mismo estructura fundamental básica, que consiste en un átomo de carbono central, también conocido como carbono alfa (α), unido a un grupo amino (-NH2), un grupo carboxilo (-COOH)y a un átomo de hidrógeno.

Cada aminoácido también tiene otro átomo o grupo de átomos unidos al átomo central conocido como Grupo R .

En eucariotas, hay múltiples copias de los 21 aminoácidos proteinogénicos (los 20 del código genético estándar, más selenocisteína) disueltos en el citoplasma de una célula y estos aminoácidos son construidos por la célula a partir de compuestos más simples o obtenidos de la dieta.

Aminoácidos esenciales para el cuerpo humano

Existen 9 aminoácidos esenciales que no puede ser producido por el cuerpo humano y debe obtenerse de la dieta.

Una lista de estos 9 aminoácidos esenciales incluye aminoácidos como:

  1. Triptófano
  2. Metionina
  3. Valina
  4. Treonina
  5. Fenilalanina
  6. Leucina
  7. Isoleucina
  8. Lisina
  9. Histidina

Diferentes tipos de 20 aminoácidos.

La naturaleza química de la cadena lateral determina la naturaleza del aminoácido (es decir, si es ácido, básico, polar o no polar).

Se pueden dividir 20 aminoácidos en los siguientes grupos:

  • Aminoácidos alifáticos: Alanina, glicina, isoleucina, leucina, prolina y valina.
  • Aminoácidos aromáticos: fenilalanina, triptófano y tirosina
  • Aminoácidos ácidos: ácido aspártico y ácido glutámico.
  • Aminoácidos básicos: arginina, histidina y lisina.
  • Aminoácidos hidroxílicos: serina y treonina.
  • Aminoácidos que contienen azufre: citosina y metionina.
  • Aminoácidos amídicos: asparaginas y glutamina.

El sitio de preguntas sobre bioquímica

Como se describió anteriormente, podemos distinguir en las proteínas cuatro niveles organizativos diferentes:

los estructura secundaria o nivel secundario de organización Se ha definido como la conformación presente en una región local del polipéptido o proteína, estabilizada mediante enlaces de hidrógeno entre los elementos del enlace peptídico.

Las estructuras secundarias organizadas se mantienen mediante enlaces de hidrógeno entre diferentes grupos peptídicos, es decir, entre el grupo N-H de un enlace peptídico y un grupo C = O de otro enlace peptídico.

Pauling y Corey, al estudiar las posibles estructuras secundarias de las proteínas, describieron que las estructuras principales que forman parte de este nivel de organización deben tener las siguientes características (Postulados de Pauling y Corey):

• Todos los aminoácidos pertenecen a la serie L estérica

• El grupo de péptidos es plano y en configuración trans.

• Cada oxígeno carbonilo y nitrógeno amídico está involucrado en la formación de enlaces de hidrógeno.

• Rotación de la molécula solo alrededor de los átomos de carbono alfa

• Los hidrógenos unidos por enlaces de hidrógeno se encuentran cerca de una línea que une los átomos de oxígeno y nitrógeno involucrados en la formación del enlace.

• La cadena lateral R de aminoácidos no está involucrada en la estructura.

Las estructuras que se consideran en este nivel secundario de organización incluyen :

Beta -turns (también conocido como Beta-bends también conocido como curvas en horquilla)

Estructura secundaria no repetitiva

Hélice alfa

Es el nivel secundario de organización de proteínas en el que la columna vertebral del polipéptido se enrolla firmemente alrededor de un eje imaginario como una estructura en espiral. (Disposición helicoidal de la cadena peptídica)

En este clip, Linus Pauling describe cómo descubrió la hélice alfa:

Características estructurales de Alpha-Helix :

& # 8211 Hay 3,6 aminoácidos por vuelta de la hélice.

& # 8211 Cada enlace peptídico es trans y plano

& # 8211 Los grupos N-H de todos los enlaces peptídicos apuntan en la misma dirección, que es aproximadamente paralela al eje de la hélice

& # 8211 C = O grupos de todos los enlaces peptídicos apuntan en la dirección opuesta, y también paralelos al eje de la hélice

& # 8211 El grupo C = O de cada enlace peptídico está unido por hidrógeno al grupo N-H del enlace peptídico a cuatro unidades de aminoácidos de él.

& # 8211 Todos los grupos R apuntan hacia afuera desde la hélice

La estabilidad de la hélice alfa se ve afectada por diferentes factores, que incluyen:

1. & # 8211 interacción electrostática entre aminoácidos sucesivos con grupos R cargados.

2. & # 8211 el volumen de los grupos R adyacentes

3. & # 8211 Interacciones entre grupos R espaciados 3 o 4 residuos.

Aproximadamente 1/4 de todos los residuos de aminoácidos en los polipéptidos se encuentran en hélices alfa, la fracción exacta varía mucho de una proteína a la siguiente.

Observe en este ejemplo las estructuras de hélice alfa en calmoludina:

Hoja beta plisada

Esta estructura secundaria se ha definido como el nivel secundario de organización de proteínas en el que la columna vertebral de la cadena peptídica (hebras Beta) se extiende en una disposición en zigzag que se asemeja a una serie de pliegues, con los enlaces peptídicos organizados en planos de pendientes alternas (alternando dirección ascendente y descendente). La hoja beta plisada se puede formar entre dos cadenas de péptidos o entre diferentes segmentos de la misma cadena de péptidos.

Las características de la hoja beta plisada incluyen

1. & # 8211 Cada enlace peptídico es plano y tiene la conformación trans

2.- Los grupos C = O y N-H de enlaces peptídicos de cadenas adyacentes apuntan entre sí y están en el mismo plano de modo que es posible la formación de puentes de hidrógeno entre ellos.

3.- Todos los grupos R- en cualquier cadena se alternan, primero arriba, luego debajo del plano de la hoja, etc.

Hay dos tipos de hojas plisadas Beta:

Antiparalelo: cuando las cadenas polipeptídicas adyacentes corren en dirección opuesta

Paralelo: cadenas polipeptídicas adyacentes que corren en la misma dirección

Por lo general, el segmento de polipéptidos que muestra una conformación Beta se denomina hebras beta individualmente y están representados por una flecha que apunta en la dirección en la que corre la hebra (desde el grupo amino hasta el carboxilo).

Ambos modelos se encuentran en proteínas, pero la estructura antiparalela es más estable que la hoja beta paralela.

El contenido de conformación beta en las proteínas es muy variable: la mioglobina, por ejemplo, no muestra este tipo de estructura secundaria, mientras que el 45 por ciento de los aminoácidos en la quimotripsina son parte de una conformación beta.

Es importante señalar que no toda la cadena polipeptídica es parte de una conformación alfa-hélice o beta. También hay curvas, segmentos enrollados irregularmente o que forman tramos extendidos: la carboxipeptidasa, por ejemplo, muestra el 38% de los aminoácidos formando hélice alfa y el 27% formando estructuras beta, por lo que alrededor del 35% de los residuos no están incluidos en estas estructuras secundarias. .

Es el nivel secundario de organización de las proteínas el que permite el cambio de dirección de la cadena peptídica para obtener una estructura plegada.

Se conocen así como vueltas inversas, curvas en horquilla o bucles Omega; ocurren a menudo en 5 residuos de aminoácidos o menos y se encuentran en la superficie de la proteína porque son hidrófilas. Los bucles de giro beta permiten la compactación de proteínas, ya que los aminoácidos hidrófobos tienden a estar en el interior de la proteína, mientras que los residuos hidrófilos interactúan con el entorno acuoso.

Observe en la siguiente figura cómo las estructuras de hélice alfa y las conformaciones Beta (hebras beta representadas por flechas) están unidas a través de curvas y giros beta que hacen que esta proteína sea compacta.

Los diferentes aminoácidos favorecen diferentes tipos de estructuras secundarias: mientras que la alanina, el glutamato y la leucina tienen una propensión a estar en hélices α, la valina y la isoleucina aparentemente favorecen las hebras β, y la glicina, asparagina y prolina tienden a estar presentes en los giros beta.

Si está interesado en obtener más información sobre la estructura secundaria, este sería un artículo muy interesante para comenzar:

El descubrimiento de la hélice α y la lámina β, las principales características estructurales de las proteínas.


Funciones de la interacción electrostática en proteínas.

Más de 60 años después de los análisis de Linderstrom-Lang y Kirkwood de sus estructuras hipotéticas de 'proteínas', ahora tenemos una plétora de evidencia experimental y estimaciones computacionales de las fuerzas electrostáticas en las proteínas, con muchísimas estructuras de proteínas en 3D a resolución atómica. Mientras tanto, al principio hubo muchos argumentos y sugerencias sobre los roles de la electrostática, principalmente a partir de hallazgos y tendencias empíricos. Algunos resultados experimentales indicaron que la contribución electrostática es del orden de varias kcal / mol, lo que en teoría era difícil de reproducir correctamente, porque un gran campo de reacción opuesto debería sustraerse de un gran campo Coulombic directo. Aunque la importancia del campo de reacción se reconoció incluso hace 70 años, las aplicaciones apropiadas a las moléculas de proteínas se hicieron solo en esta década, con el desarrollo de la computación numérica. Ahora, una superficie molecular electrostática es una de las imágenes más populares en las revistas de biología estructural, lo que indica que la fuerza electrostática es uno de los componentes importantes que contribuyen al reconocimiento molecular, que es un enfoque importante de la biología y bioquímica actuales. El desarrollo de técnicas de RMN ha permitido observar las ionizaciones individuales de grupos ionizables en una proteína, además de la determinación de la estructura 3D. Dado que no requiere ninguna sonda adicional, cada estado de carga puede informar los potenciales electrostáticos muy locales y heterogéneos que trabajan en la proteína, sin perturbar el campo original. A partir de los valores de pKa, se han evaluado correctamente las contribuciones de las interacciones electrostáticas, los pares de iones, las interacciones carga-dipolo y los enlaces de hidrógeno a la estabilidad de las proteínas. La ingeniería de proteínas también proporciona mucha más información que la que se puede obtener a partir de las proteínas nativas, ya que los residuos en cuestión ahora pueden sustituirse fácilmente con otros residuos de aminoácidos que tienen características electrostáticamente diferentes. Esos resultados experimentales han revelado contribuciones más pequeñas de lo esperado anteriormente, probablemente porque subestimamos los efectos del campo de reacción. Especialmente, un solo par de iones estabiliza una proteína solo ligeramente, aunque una red cooperativa de puentes de sal puede contribuir significativamente a la estabilidad de la proteína. Las estabilidades marginales de las proteínas surgen de una pequeña diferencia entre muchos factores con fuerzas impulsoras y opuestas. A pesar de la pequeña contribución de cada interacción electrostática a la estabilidad de la proteína, la suma de sus acciones trabaja para mantener la estructura 3D específica de la proteína. Cabe señalar las funciones "negativas" de la electrostática, que podrían desestabilizar la conformación de las proteínas. Las cargas enterradas no apareadas son energéticamente demasiado caras para salir en el núcleo hidrofóbico. Los donantes y aceptores de enlaces de hidrógeno aislados también ejercen efectos negativos, pero no son tan costosos como las cargas enterradas no apareadas, con costos de unas pocas kcal / mol. Por lo tanto, los análisis estadísticos de las estructuras de proteínas en 3D revelan solo casos raros de donantes y aceptores de enlaces de hidrógeno aislados. Esta debe ser la razón principal por la que las hélices alfa y las hojas beta solo se observan en los núcleos de proteínas como estructuras de la columna vertebral. Tales estructuras secundarias no dejan a ningún donante o aceptador de hidrógeno de la cadena principal sin aparear, debido a su empaquetamiento intrínsecamente regular. De lo contrario, podría ser muy difícil construir una estructura de cadena principal, en la que todos los grupos amida y carbonilo de la cadena principal tuvieran sus propios enlaces de hidrógeno asociados en el núcleo de la proteína. Hay dos enfoques teóricos de la electrostática de proteínas, el modelo macroscópico o continuo y el modelo microscópico o molecular. Como se describe en este artículo, el modelo macroscópico tiene problemas inherentes porque el sistema proteína-disolvente es muy heterogéneo desde el punto de vista físico.


Estructura proteica

Hay cuatro niveles distintos de estructura proteica.

La estructura primaria es la secuencia de diferentes aminoácidos en una proteína.

La estructura secundaria se refiere a subestructuras locales muy regulares. Dos tipos principales de estructura secundaria, la hélice alfa y la hebra beta.

La estructura terciaria es la estructura tridimensional de una molécula de proteína.

La estructura cuaternaria es un ensamblaje más grande de varias moléculas de proteínas.

1. Estructura primaria:

Las proteínas son moléculas grandes hechas de aminoácidos que se unen covalentemente para formar un polímero:

los estructura primariase refiere a la secuencia lineal de la cadena de aminoácidos. La estructura primaria se mantiene unida por enlaces covalentes (el enlace peptídico).

¿Cuál es el grupo funcional formado (enlace peptídico)?

Lo que se forma el producto secundario?

¿Es la columna vertebral principal (polar o no polar)? Un círculo.

estructura de la proteína primaria es un ejemplo de una [polímero o ensamblaje supramolecular] ? Un círculo.

2a. Estructuras secundarias y hojas beta ndash

Las proteínas se pliegan en una o más conformaciones espaciales específicas y ndash estructura secundaria. El IMF mantiene las estructuras secundarias en su lugar entre los grupos funcionales de la columna vertebral.

Las hojas beta consisten en hebras beta(mostrado abajo) conectados lateralmente por IMF, formando una hoja plisada generalmente retorcida.

¿Qué mantiene el FMI a estos dos hilos juntos?

Indique claramente en la imagen de arriba qué átomos están involucrados en estos IMF.

Las láminas beta pueden ser paralelas (dos hebras que corren en la misma dirección) o antiparalelas (direcciones opuestas.

Decide cuáles de las siguientes imágenes son paralelas y cuál es antiparalela.

2b. Estructuras secundarias: Helices alfa

los hélice alfa (y hélice alfa)es otro ejemplo de estructura secundaria de proteínas.

La hélice alfa es una conformación en espiral en la que cada columna vertebral de la proteína completa una espiral completa cada ___________residuos.

Una vez más, las fuerzas intermoleculares de la columna vertebral de la proteína mantienen este motivo estructural en su lugar.

¿Qué sostiene el FMI en una bobina de este hilo?

Indique claramente en la imagen de arriba qué átomos están involucrados en estos IMF.

2c. Estructuras secundarias: Helices alfa

Un gráfico de rueda helicoidal es una representación bidimensional de los residuos de una hélice alfa en la que mira hacia abajo del eje.

Esta es una rueda helicoidal para la secuencia:

abcdeABCDE123456789

Aquí hay una secuencia real que forma una hélice alfa:

Para los aminoácidos en esta secuencia:

Cree su rueda helicoidal trazando la posición de cada aminoácido en la gráfica de la rueda helicoidal de arriba, incluidos los círculos y los cuadros. Comenzar con la leucina en la a. Continúe colocando los otros aminoácidos alrededor de la rueda.

Si es posible, cree también un modelo de mano con limpiapipas y un tubo de espuma de poliestireno.

Identifique los residuos hidrofílicos rodeándolos con un círculo.

Identifique los residuos hidrófobos encuadrándolos.

¿Qué cara de la hélice alfa es más probable que se enfrente a una solución de agua?

¿Qué cara de la hélice alfa es más probable que mire hacia el interior de la proteína?

3. Estructuras Terciarias

El empaquetamiento de los elementos de la estructura secundaria de las proteínas en unidades globulares compactas se forma estructura terciariade una proteína. Las proteínas están empaquetadas de tal manera que se encuentra muy poca agua dentro de la proteína plegada. El plegado es impulsado por el inespecíficointeracciones hidrofóbicas (el entierro de residuos hidrofóbicos del agua).

[Hidrofóbico o hidrofílico] es más probable que los aminoácidos se encuentren en la superficie de la proteína. Un círculo.

[Hidrofóbico o hidrofílico] Lo más probable es que los aminoácidos se encuentren enterrados en la proteína plegada. Un círculo.

Si una cadena lateral de Val está unida enterrada en la proteína (no expuesta al agua), ¿qué otras cadenas laterales de aminoácidos podrían estar a su alrededor?

4. estructuras cuaternarias

Estructura cuaternariaes la estructura 3D de una proteína de múltiples subunidades y cómo encajan las subunidades.

Si se trata de un monómero, dibuja una caricatura de un tetrámero.

Las subunidades se mantienen juntas, incluidos los puentes salinos y los enlaces de hidrógeno. Identifique estos atractivos del FMI en la imagen.

La estructura de la proteína cuaternaria es un ejemplo de [polímero o ensamblaje supramolecular] ? Un círculo.

Plegado de proteínas

Plegado de proteínases el proceso por el cual la estructura de una proteína asume su forma o conformación funcional. Es el proceso físico mediante el cual un polipéptido se pliega en su estructura tridimensional característica y funcional a partir de una espiral aleatoria.

La desnaturalización de proteínas

Desnaturalizaciónes un proceso en el que las proteínas pierden su estructura secundaria o terciaria que está presente en su estado plegado.

Dibuja una caricatura para el proceso de desnaturalización.

A nivel molecular, describe lo que sucede cuando se desnaturaliza una proteína.

Sugiera 2-3 cosas diferentes que puedan causar desnaturalización.

Si las proteínas de las células vivas se desnaturalizan, ¿qué le podría pasar a la célula?

Problemas de práctica de proteínas

Dibuje todos los estereoisómeros posibles de treonina y asigne la nomenclatura R, S a cada uno.

Dibuja la estructura del siguiente péptido:

Los segmentos helicoidales ( alpha ) de proteínas se detienen siempre que se encuentra una prolina en la cadena. Sugiera una razón por la que la prolina no se encuentra en una hélice ( alpha ).

Pro es el aminoácido que se encuentra más comúnmente en ( beta ) - vueltas. Discutir las razones de esta observación.

Foldit es un nuevo y revolucionario juego de computadora que le permite contribuir a importantes investigaciones científicas.

Dartnell, Lewis New Scientist. 8/11/2008, vol. 199 (2681), págs. 36-39.

Lea sobre el juego de plegamiento de proteínas en el sitio web y / o el artículo de New Scientist.

Intenta doblar una proteína. ¡Verifique si su instructor ha configurado un grupo privado! https://fold.it/portal/node/996074

Un resumen (en sus propias palabras) que responde a las siguientes preguntas:

¿Por qué los científicos están interesados ​​en el plegamiento de proteínas?

¿Por qué convertirlo en un juego de computadora en lugar de que una computadora resuelva la estructura?

¿Qué proteína intentaste doblar?

¿Por qué era importante tu proteína?

Proporcione una captura de pantalla de su intento. (O si tu instructor ha hecho un grupo privado, podrá seguir tus intentos).

Receptor de Teoría

los sitio activoes el surco o bolsa tridimensional de una enzima o receptor donde las moléculas se unen y experimentan una reacción química o desencadenan una respuesta.

Para interactuar con el sitio activo, el sustrato:

a) debe mantenerse en el sitio activo con fuerzas intermoleculares con las cadenas laterales de aminoácidos.

b) debe & ldquofit & rdquo en el sitio activo. (Tamaño y la geometría y la orientación)

Una. Encuadernación: Fuerzas electrostáticas

Los sustratos se unen a receptores y enzimas mediante interacciones covalentes o no covalentes.

A continuación se muestra una caricatura de una parte de una molécula de péptido (círculo interior) que interactúa con una enzima. Las líneas discontinuas muestran fuerzas intermoleculares que mantienen el sustrato a la enzima.

B. Encuadernación: ajuste, tamaño y geometría

Los receptores y las enzimas tienen forma tridimensional, por lo que la estructura del sustrato debe encajar.

C. Encuadernación: Estereoquímica

Además, la estereoquímica marca una gran diferencia. A continuación se muestra una caricatura de dos enantiómeros y cómo interactúan con un receptor.

Cuando estructura A enlaza, aprovecha al máximo todas las interacciones posibles (como una mano en un guante o una llave en una cerradura y ndash, encaja perfectamente). Su enantiómero, estructura B, no puede aprovechar todas las interacciones.

Es estructura A o estructura B atado más fuerte? Un círculo.

Dibujar la proyección de Newman de la Estructura B girado 60, 120 y 180 grados.

¿Es alguna conformación de estructura B ¿Puede aprovechar al máximo todos los posibles bolsillos de encuadernación?

Solo un isómero del compuesto deuterado a continuación es un sustrato para una desfosforilasa que da anti-eliminación a la Z-isómero (también se muestra a continuación).

Etiquete los estereocentros con R o S en estos dos isómeros.

¿Cómo se relacionan estos isómeros entre sí?

enantiómeros diastereoisómeros conformadores

Utilizando la teoría del receptor, explique por qué solo uno de estos isómeros reacciona con la enzima para formar un producto.

Problemas con la aplicación de proteínas

unión al receptor nicotínico

Cuantas más interacciones pueda tener un ligando con un receptor o enzima, más fuertes se unirán entre sí.

La acetilcolina (la estructura que se muestra a continuación) interactúa con un sitio de reconocimiento en la subunidad a del receptor nicotínico.

Muestre las interacciones con la acetilcolina.

Estereoquímica de diseño de fármacos.

Lea el siguiente artículo sobre la estereoquímica de un fármaco: http://www.ncbi.nlm.nih.gov/pmc/articles/PMC353039/

Dibuje una caricatura que represente cómo un enantiómero de un fármaco quiral se unirá más estrechamente a una enzima.

Proporcione un ejemplo de un medicamento actual que tenga solo un enantiómero activo.

Actualmente, no existe un mandato regulatorio en los Estados Unidos o Europa para desarrollar nuevos medicamentos exclusivamente como enantiómeros únicos y la compañía farmacéutica puede elegir si buscar un enantiómero racémico o puro para un nuevo medicamento. Argumente si la FDA debería exigir o no medicamentos enantioméricamente puros para el mercado.

Nanotubos de péptidos cíclicos como canales de iones de membrana

Se demostró que los péptidos cíclicos se autoensamblan en las membranas celulares para formar canales iónicos selectivos de tamaño transmembrana y transportar moléculas biológicamente relevantes, como la glucosa, a través de la bicapa lipídica. Biophys J. 2003 Octubre 85 (4): 2287 & ndash2298 Chem. Soc. Rev., 2012, 41, 6023 y ndash6041 J. Am. Chem. Soc. 1998, 120, 4417-4424

Autoensamblaje de péptidos cíclicos

La N-metilación, que reemplaza parte del H & rsquos en el nitrógeno con CH3, limita el proceso de autoensamblaje a dos subunidades (solo forma un dímero, vea la imagen a continuación).

¿Qué mantiene unidos los péptidos cíclicos apilables (ver imagen a continuación)?

Indíquelo en la imagen de abajo usando líneas discontinuas o resaltador.

Explique por qué solo dos subunidades pueden unirse después de la N-metilación.

Nanotubos (cont.): Diseño de péptidos cíclicos

Nombre el grupo funcional encerrado en un círculo en el péptido cíclico que se muestra arriba.

¿Cuántos centros quirales hay en el péptido cíclico anterior?

¿Cuántos estereoisómeros son posibles para este péptido cíclico?

En el cuadro siguiente, el uso de cuñas y guiones dibuja dos cadenas laterales de alanina (Ala), ambas como el estereoisómero R, en la columna vertebral del péptido a continuación.

En el círculo de abajo, usando cuñas y guiones dibuje dos cadenas laterales de alanina (Ala), una como el estereoisómero R y otra como el estereoisómero S, en la columna vertebral del péptido de abajo.

El objetivo es hacer tubos huecos (nanotubos). Usando sus imágenes de arriba, explique por qué necesitan cambiar entre los aminoácidos R y S a medida que giran alrededor del péptido cíclico.

¿Por qué cada péptido cíclico está formado por un número par de aminoácidos?

Nanotubos (cont.): Formación de canales a través de la membrana celular

Los péptidos cíclicos apilados supramoleculares se utilizan para crear iones y canales de transporte (tubos) a través de la membrana celular.

Los aminoácidos que se usan comúnmente para producir el péptido cíclico son fenilalanina (Phe), alanina (Ala), leucina (Leu).

Estos aminoácidos tienen cadenas laterales que son: (circule la respuesta correcta)

polar no polar cargada positivamente cargada negativamente

Dibuja dos de estos aminoácidos que salen del cilindro de abajo. Muestre claramente si la cadena lateral de aminoácidos está interactuando con la cabeza o la cola de la membrana celular.

¿Qué tipo de fuerzas intermoleculares mantienen los cilindros en la membrana celular?

Nanotubos (cont.): Transporte de iones y glucosa a través de la membrana celular

Cuando se usa un número diferente de aminoácidos para hacer el péptido cíclico, el tamaño de los poros (diámetro interno) cambia.

Número de aminoácidos Tamaño de poro ( Que encaja en el canal
4 4
8 8
10 13

Los estudios actuales sobre estos canales de péptidos cíclicos autoensamblados en las membranas celulares implican estudios de administración de fármacos y antibacterianos.

Dibuja glucosa en su conformación de silla más estable.

¿Cuál es la geometría de Fe en Fe (CN)?6 3- ?

Cada una de estas tres opciones encaja bien en uno de los canales enumerados anteriormente. Agregue estos a la mesa.

Compare el tamaño de Na+ y K +. Si quisiera diseñar un canal selectivo para Na +, ¿cuántos aminoácidos usaría?

Explorando las interacciones de las macromoléculas biológicas con iones / moléculas pequeñas

La función biológica de macromoléculas como el ADN y las proteínas implica invariablemente la unión de otras moléculas a ellas. Los bioquímicos llaman ligandos a estas otras moléculas o iones. La unión de ligandos a proteínas y ácidos nucleicos se produce a través de las conocidas fuerzas intermoleculares que ya ha estudiado. Puede visualizar estas interacciones observando la estructura 3D del complejo macromolécula: ligando, cuyas coordenadas de cristal de rayos X se depositan en el Protein Data Bank en forma de archivos pdb. Haga una búsqueda en Google en pdb y siga los enlaces al banco de datos de proteínas RCSB. Una vez allí, escriba en la ID de PDB o en las barras de búsqueda de texto en el menú superior el número de PDB para uno de los complejos que se muestran en las tablas a continuación. El uso utilizará un programa llamado Ligand Explore para visualizar el ligando unido.

Iniciar Explorador de ligandos: desplácese hacia abajo hasta la sección Componente químico de ligandos en el medio de la página que se muestra para ese complejo. Seleccione Explorador de ligandos en la fila con el nombre del ligando. A continuación se muestra un ejemplo.

Es posible que se le solicite que permita las ventanas emergentes del sitio. Si es así, permítelo. Es posible que deba volver a seleccionar Ligand Explorer para iniciar el programa. Siga otorgando permisos y siguiendo las instrucciones hasta que Ligand Explorer esté abierto. Una vez iniciado, seleccione la pestaña Ayuda y las instrucciones se abrirán en un navegador. Utilice el mouse para ayudar a encontrar la mejor vista de las interacciones.

Asignación: cada tabla seleccionará una estructura PDB única y presentará un PowerPoint de una página en la clase en el que muestra capturas de pantalla (ver más abajo) con leyendas claras que representan los IMF involucrados en la unión del ligando a su proteína.

Use Ligand Explorer: en el lado izquierdo de la ventana Ligand Explorer -

Los átomos de oxígeno y nitrógeno de los archivos PDB están codificados con colores en la mayoría de los programas de visualización como rojo y azul, respectivamente. Los enlaces H se muestran entre un átomo de O rojo y un átomo de N azul, que son tanto electronegativos como ligeramente negativos. Los átomos de H no se muestran en archivos de estructura obtenidos mediante cristalografía de rayos X. Suponga que hay un átomo de H en uno de los átomos comprometidos en un enlace de hidrógeno.

Captura de capturas de pantalla recortadas: PC: seleccione el icono de Windows en la parte inferior izquierda y escriba Snipping Tool en los programas de búsqueda. Siga las indicaciones. Mac: selecciona Comando-Mayús-4. Aparecerá un cursor en forma de cruz. Haga clic y arrastre para seleccionar el área. Cuando suelte el botón del mouse, la captura de pantalla se guardará como un archivo PNG en su escritorio.

A. Macromolécula: interacciones medicamentosas

Clase Macromolécula Droga Descripción PDB #
antibióticos D-alanil-D-alanina carboxipeptidasa penicilina inhibe la enzima que construye las paredes celulares bacterianas 1pwc
antivírico Proteasa del VIH saquinavir inhibe una enzima necesaria para la maduración del VIH 1hxb
antivírico neuramidasa Tamiflu Tamiflu es un medicamento contra la influenza. 2hu4
anticáncer ADN bleomicina se une al ADN en células en crecimiento activo, a menudo escindiendo la cadena de ADN 1 mxk
anticáncer Tubulina taxol se une a la tubulina, evitando la acción de los microtúbulos durante la división celular 1jff
anticáncer ADN cisplatino se une y provoca la reticulación del ADN que finalmente desencadena la apoptosis (muerte celular programada). 3lpv
Señal telefónica Receptor beta-adrenérgico carazolol Los betabloqueantes se unen e inhiben el receptor adrenérgico utilizado para combatir la enfermedad cardíaca. 2rh1
Señal telefónica Prostaglandina H2 sintasa aspirina inhibe la enzima ciclooxigenasa, que produce prostaglandinas que señalan el dolor. 1pth
Enfermedades de la opulencia Lipasa pancreática fosfonato de alquilo inhibe la lipasa pancreática, reduciendo la cantidad de grasa que se absorbe de los alimentos. 1 libra
Enfermedades de la opulencia HMG-CoA reductasa Atorvastatina (Lipitor) inhibe la HMG-CoA reductasa, una enzima involucrada en la síntesis de colesterol. 1hwk

B. Interacciones de proteínas: carbohidratos (CHO)

Clase Proteína Carbohidrato Descripción PDB #
Lectina y ndash (proteína de unión a CHO) Concavalin A dimanosa Con A es de Jack Bean y se utiliza para estudiar y purificar las proteínas de unión a carbohidratos. 1I3H
transportador Permeasa de lactosa Tiodigalactósido (un análogo de lactosa) La lactosa permeasa de Escherichia coli transporta lactosa a través de las membranas celulares 1pv7
Lectina humana P-Selectina SLEX (un carbohidrato) SLeX, es un tetrasacáridocarbohidrato que se encuentra en la superficie de las células. Participa en el reconocimiento de célula a célula y es uno de los antígenos de grupo sanguíneo más importantes. La P-selectina es una proteína que se encuentra en los leucocitos, 1g1r

C. Proteínas: interacciones lipídicas

Clase Proteína Droga Descripción PDB #
Unión de ácidos grasos insolubles en las células Proteína de unión a lípidos Adipoctye Ácido arachadónico Proteína intracelular implicada en la bioquímica de ácidos grasos ciclooxigenasa COX-2 (código PDB: 1CVU), 1adl
Unión y transporte de ácidos grasos en sangre. Albúmina de suero humano ácido esteárico, La albúmina es la proteína más abundante en el suero sanguíneo. Se une a moléculas no polares como los ácidos grasos. 1e7i
Escindir los ácidos grasos de las grasas almacenadas (triglicéridos) Fosfolipasa A2 Octil sulfato Libera ácido graso de los triglicéridos. Se encuentra en las células y también se secreta a partir de las células. 3fvi

D. Proteína: interacciones entre moléculas pequeñas

Clase Proteína Droga Descripción PDB #
Hormona Receptor de estrógeno Tamoxifeno El tamoxifeno, un imitador del estrógeno, se usa para tratar el cáncer al bloquear la acción del estrógeno. 3ert
Moléculas tóxicas Glicoproteína P inhibidores de hexapéptidos cíclicos, cíclicostris- (R) -valinéslenazol La proteína es la bomba molecular más común, eliminando moléculas tóxicas (desafortunadamente también medicamentos quimioterapéuticos) de las células. 3g60
Moléculas tóxicas Citocromo P450 Eritromicina (un antibiótico) CYP3A4 es el citocromo p450 que desempeña el papel principal en la desintoxicación de fármacos y contribuye al metabolismo de aproximadamente el 50% de los fármacos comercializados. 2j0d
Hormona Globlulina fijadora de hormonas sexuales testosterona La testosterona se transporta dentro de las proteínas portadoras en la sangre, incluida la albúmina sérica y la globulina transportadora de hormonas sexuales. 1d2s
Hormona dominio de unión a testosterona tetrahidrogestrinona (THG) tetrahidrogestrinona (THG) es un esteroide anabólico sintético de diseño. 2amb
Neurotrans Receptor de acetilcolina Carbamoil colina Este receptor de neurotransmisores cerebrales es parte del sistema de receptores de ácido nicotínico. 1uv6
Neurotrans Receptor de dopamina D3 humano eticloprida Estructura del receptor D3 de dopamina humano en complejo con eticloprida, un antagonista de la dopamina 3pbl

E. Proteína: Interacciones de metales

Clase Proteína ion Descripción PDB #
transporte Transferrina Planchar La transferrina transporta el Fe en sangre, lo secuestra y evita que se oxide a la forma férrica 3+ más insoluble. 1h76
almacenamiento Ferritina Planchar Proteína intracelular que forma una capa que secuestra iones Fe. 1fha
La expresion genica Gal 4 Zn Los iones de Zn ayudan a estabilizar una estructura de "dedos" en la proteína, lo que le permite unirse y regular la actividad de los genes. 1d66
Celda de señalización para responder calmodulina calcio Calmodulina (proteína moduladora del calcio), al unirse a los iones de Ca intracelulares, cambia de forma y provoca respuestas celulares. 1exr

F. Proteína: Interacciones de Drogas de Abuso

Elija un ligando para analizar

Seleccione a su vez enlace de hidrógeno, enlace H hidrofóbico, puente (mediado por una molécula de agua) e interacción de metal. Tome una captura de pantalla recortada de cada interacción.

Para el renderizado final, mueva el conmutador en Seleccionar superficies a opaco. Luego cambie la distancia de la mejor manera para mostrar la cavidad en la que se une el ligando. Colorear por hidrofobicidad lo que da dos colores que representan las partes no polares y polares de la cavidad. Seleccione sólido superficies.

Esté preparado para explicar en clase las interacciones que se muestran en cada interpretación.

Tarea grupal acumulativa: bioquímica y rsquos Next Top Model

Ha descubierto una nueva proteína aislada de una membrana celular. Una verificación inicial de las bases de datos de proteínas indica que su secuencia está estrechamente relacionada con las proteínas que transportan la glucosa a través de las membranas celulares.

Ahora deberá recopilar otros detalles estructurales en función de su secuencia. Esta práctica de laboratorio le mostrará algunas de las cosas que puede hacer con una computadora, pero también las limitaciones de la predicción de estructuras.

La secuencia principal de la nueva proteína se enumera a continuación en códigos de una letra. En este laboratorio, trabajará con la computadora y luego tratará de construir un modelo físico de la proteína usando alambre.

El análisis consta de cuatro partes.

Parte 1: Hidropatía y cruce de membrana

Parte 2: Predicción de estructuras secundarias

Parte 3: Construcción de un modelo

Parte 4: Estructura terciaria por computadora (opcional)

Nombres de miembros del grupo:

MEDDDGGLCLAVLVAMFFLGIMLLPSLANPPGRKGALLFAAIFCILAILMGVSAEG PKNRGALGIVLAAALCLVAIFGLRNQQSNSDGWPILLALTAQLAALCVLLLPFFPE SPRYQKKS

Parte 1: Hidropatía y cruce de membrana

La mayoría de las proteínas unidas a la membrana cruzan la membrana celular varias veces, por lo que el primer paso es construir un diagrama de hidropatía de la proteína. Esto le permitirá estimar cuántas veces la proteína atraviesa la membrana celular. La escala de hidropatía a continuación da una puntuación positiva a las cadenas laterales hidrófobas y puntuaciones negativas a las cadenas laterales hidrófilas.

Haz un diagrama de hidropatía simple:

Para hacer un diagrama de hidropatía simple, abra un archivo de MS Excel que se le envió llamado Next_Top_Model_Data. La columna 1 tiene la secuencia de aminoácidos y la columna 2 tiene el número de residuo. Agregue puntuaciones de hidropatía a la columna 3 y luego haga un & lsquoColumn Graph & rsquo en formato 2D.

Los gráficos de hidropatía utilizan un valor medio de los residuos antes y después del residuo en cuestión. En el siguiente ejemplo, la puntuación media de hidropatía para el ácido aspártico en la celda C4 es una media de las puntuaciones de las células C2 a C6. Puede escribir & lsquo = average (C2: C6) & rsquo para que Excel haga un promedio en la celda D4. A continuación, arrastre la esquina inferior derecha de la celda D4 hasta el final de la columna. (Los residuos 1 y 2 no tendrán un valor promedio). Ahora tendrá una hidropatía promedio para cada residuo que abarque ese residuo más los dos anteriores y los dos posteriores. Estos datos se utilizarán con fines gráficos.

Haga un & lsquoColumn Graph & rsquo en formato 2D de la hidropatía promedio (eje y) y el número de residuo. Excel también puede trazar los números de fila, por lo que es posible que deba hacer clic con el botón derecho en el gráfico y eliminar la Serie 1 o 2 en & lsquoSelect Data & rsquo. Asegúrese de que el número de residuo esté en el eje x. (En Excel 2007, es posible que deba ir al panel & lsquoDesign & rsquo y hacer clic en & lsquoSwitch Axes & rsquo.)

Responde estas preguntas según tu trama:

De su gráfico de hidropatía, ¿cuántas veces parece que la proteína atraviesa la membrana celular? (Considere lo que podrían indicar los valores positivos y negativos).

Aproximadamente, ¿cuántos aminoácidos parece necesitar para cruzar una membrana?

Si el extremo N de la proteína está dentro de la célula, ¿dónde se encuentran los residuos 30-35?

¿El extremo C-terminal es intracelular o extracelular?

Teniendo en cuenta lo que sabe acerca de la posición general de las cadenas laterales y los átomos de la cadena principal en hélices a y hebras b, ¿cree que las porciones que cruzan la membrana probablemente serán hélices a o hebras b? (Nota: Esta pregunta será respondida más adelante, así que solo haga una suposición / hipótesis fundamentada aquí).

Opcional: La literatura generalmente muestra diagramas de dispersión XY con una línea que conecta los puntos para la hidropatía. Son más comunes, pero más difíciles de leer.

Puntuaciones de hidropatía de aminoácidos

Nombre del aminoácido Código de una letra Puntuación de hidropatía
Isoleucina I 4.5
Valina V 4.2
Leucina L 3.8
Fenilalanina F 2.8
Cisteína C 2.5
Metionina METRO 1.9
Alanina A 1.8
Glicina GRAMO -0.4
Treonina T -0.7
Triptófano W -0.9
Serina S -0.8
Tirosina Y -1.3
Prolina PAG -1.6
Histidina H -3.2
Ácido glutamico mi -3.5
Glutamina Q -3.5
Ácido aspártico D -3.5
Asparagina norte -3.5
Lisina K -3.9
Arginina R -4.5

Referencia de la puntuación de hidropatía: Kyte, J. y Doolittle, R. 1982. Un método simple para mostrar el carácter hidropático de una proteína. J. Mol. Biol. 157: 105-132.

Parte 2: Predicción de estructuras secundarias

Predecir la estructura 3D directamente a partir de una secuencia de proteína primaria es "el santo grial" de la bioquímica. Actualmente, solo se puede hacer si se conoce la estructura de una proteína muy similar. Sin embargo, los elementos estructurales secundarios se pueden predecir con relativa precisión, ya que los estudios han demostrado que es más probable que ciertos aminoácidos estén en hélices a o hebras b. En esta parte, tomará su secuencia y predecirá algunos elementos estructurales secundarios. Ve a la RASGUÑO sitio web que tiene programas que realizan muchas funciones relacionadas con las proteínas. Una vez allí, ingrese su dirección de correo electrónico, la secuencia que aparece en la primera parte de la práctica de laboratorio, y luego haga clic en el SSPROcaja. En unos minutos recibirá un correo electrónico con un código por cada residuo de aminoácido que envió. (Podría ir a su correo no deseado).

los SSPRO La salida tiene tres códigos posibles. Pegue la salida a continuación.

H = Hélice

E = Estructura beta extendida

C = Giros, vueltas y estructuras indefinidas

Responda estas preguntas según su predicción de estructura secundaria:

¿Cómo coinciden los probables segmentos transmembrana de la secuencia con los segmentos helicoidales del programa SCRATCH? (Puede ser útil pegar los resultados de SCRATCH debajo de la secuencia principal en la página 1.)

Utilice los datos a continuación sobre las hélices a y sus datos para estimar el grosor de una membrana celular.

Un ( alpha )-helix da una vuelta cada 3.6 residuos. El paso o avance por vuelta es de 0,54 nm (nanómetros).

Los residuos 30-33 (PPGR) parecen conectar la hélice 1 y la hélice 2. Según el número de residuos entre las hélices 1 y 2, ¿qué tipo de estructura representan los residuos 30-33 más probablemente?

La hélice 1 termina aproximadamente en el residuo 30 donde hay una prolina. Explique por qué tiene sentido que la prolina aparezca cerca del final de una hélice a. (Sugerencia: piense en el patrón de unión H).

A continuación se muestra una bicapa de membrana (suponga que el área debajo de ella está dentro de la celda). Copie la imagen y cárguela en el programa Paint de su computadora. (El programa está en & lsquoAccessories & rsquo en la lista de programas). En Paint, elija el pincel con un punto de tamaño mediano y dibuje la proteína con el mouse. Intente mostrar alrededor de 5 vueltas por hélice a medida que atraviesan la membrana. Cuando termine, guarde su archivo y péguelo nuevamente en este documento. Puede eliminar el original.

Parte 3: Estructura terciaria / 3D Parte 3: Estructura terciaria / 3D

Como se señaló anteriormente, la predicción de la estructura 3D es realmente un desafío ya que los residuos muy separados en la secuencia primaria pueden terminar uno al lado del otro en la estructura 3D. En esta parte del laboratorio, intentará construir un modelo físico de su proteína usando un cable y varios otros suministros. ¡El modelo más atractivo obtendrá un premio increíble! Algunas suposiciones para el modelo son:

Suponga que cada residuo de amino tiene 1 pulgada de largo. Dado que la secuencia tiene 120 aminoácidos, necesitará un trozo de cable de 120 pulgadas (10 pies). hay varios tipos disponibles. Tenga en cuenta que algunos tienen bordes algo afilados.

Colorea el término N en azul y el término C en rojo. (agregar cinta sobre el fabricante evitará que se corra)

Si construye una hélice ( alpha ) -, una vuelta de la hélice debe ser de 3.6 pulgadas de cable. Los enlaces H que conectan el giro en una ( alpha ) - hélice deben ser

Separación de 0.6 pulgadas y vaya de 'bucle en bucle' en la misma hélice. pruebe algunos cables cortos para agregar algunos ejemplos de enlaces H.

Para bucles y estructuras extendidas que no están en la membrana celular, simplemente estire el cable con cada residuo de 1 pulgada de largo.

La secuencia también tiene 4 residuos de cisteína que parecen estar en enlaces disulfuro. Las posiciones aproximadas de cisteína en la hélice se enumeran a continuación. Utilice un cable rojo corto para hacer los enlaces disulfuro más lógicos.

Observe cómo se compacta su estructura midiendo la distancia entre los extremos N y C. El cable mide 10 pies si se estira.

Parte 4: Predicción de la estructura terciaria (opcional)

Como pieza opcional final del laboratorio, puede probar un predictor de formas 3D proporcionado por el sitio web de SCRATCH. Ve a la RASGUÑO sitio web y agregue su dirección de correo electrónico y pegue la secuencia desde el comienzo de la práctica de laboratorio. Esta vez, haga clic en el cuadro 3Dpro y recibirá un correo electrónico con una predicción por computadora de la estructura 3D. (Esto puede demorar hasta 30 minutos y la estructura será un archivo adjunto). Una vez que obtenga la estructura, puede moverla con el botón izquierdo del mouse y su mouse derecho tiene opciones de color, etc.)

Nota:Si la proteína no se muestra correctamente, haga clic con el botón derecho en la estructura y en & lsquoDisplay & rsquo elija & lsquoBackbone & rsquo.

IV. Base Pares - & gt ADN Helices

El ADN es un polímero hecho de monómeros de ácido nucleico.

El ADN está compuesto por un par de polímeros de una sola hebra que se mantienen estrechamente juntos en forma de doble hélice.
Piense en la doble hélice como una escalera retorcida. Los lados consisten en un motivo de azúcar-fosfato que se repite y los peldaños entre las hebras son pares de bases.

El ADN es una molécula estable estabilizada por varias fuerzas intermoleculares.

Dibuja el enlace de hidrógeno entre estas dos hebras de ADN.

¿Qué bases & ldquopair & rdquo entre sí en el ADN?

¿Cuántos enlaces de hidrógeno se forman entre cada uno de estos pares?

Los pares de bases AG y CT no ocurren típicamente. Veamos & rsquos algunas razones.

Imagine el ADN como una escalera (abajo).

Hay dos problemas de pares AG y CT usando la imagen de escalera:

A y G son demasiado [grandes o pequeños], lo que provoca una tensión _______________.

C y T son demasiado [grandes o pequeños], lo que lleva a una _____________ más débil. Piense en la ley de Coulomb.

En términos de enlaces de hidrógeno:

Compare el número de enlaces de hidrógeno en el par de bases A: G con el número de enlaces de hidrógeno en el par de bases C: G (página anterior).

¿Cuál sería más estable?

Problema de aplicación del par de bases de ADN

A cianófago es un virus que infecta a las cianobacterias.

En el cianófago S-2L, se usa diaminopurina (DAP) en lugar de adenina. DAP se empareja perfectamente con la timina formando 3 enlaces de hidrógeno intramoleculares.

Identifica los 3 enlaces de hidrógeno.

A-T forma 2 enlaces de hidrógeno. Se ha sugerido que el cambio a DAP de Adenine, ayuda al virus cianófago a evadir el sistema inmunológico del huésped bacteriano.

Proponga una razón por la que DAP ayuda a sobrevivir al virus.

Antes de que Rosalind Franklin (y Watson y Crick) determinaran la estructura del ADN, Chargaff señaló que la cantidad total de A + G en el ADN es igual a la cantidad de C + T, independientemente del tipo de ADN. Explique esta observación.

Considere el oligómero monocatenario que se muestra a continuación:

Encierra en un círculo los grupos funcionales fosfato.

Pon una caja alrededor del azúcar.

Dibuja la hebra complementaria que muestra las interacciones entre los pares de bases.

Una sola hebra de ADN es un ejemplo de [polímero o ensamblaje supramolecular] ? Un círculo.

Una doble hélice de ADN es un ejemplo de [polímero o ensamblaje supramolecular] ? Un círculo.

Hélice de ADN quiral

Las hélices pueden ser diestras o zurdas.

Si lo sostiene apuntando en dirección opuesta a usted y gira en el sentido de las agujas del reloj alejándose, es diestro; de lo contrario, es zurdo. Estos modelos son imágenes en espejo y no se pueden convertir uno en otro mediante rotación.

Las formas A y B de ADN son hélices diestras, pero el ADN-Z es una hélice zurda.

¿Es el ADN de esta imagen una hélice para diestros o zurdos?

Desnaturalización del ADN

Las dos hebras del ADN de doble hélice se mantienen unidas por interacciones no covalentes relativamente débiles (enlaces de hidrógeno y apilamiento de bases) y se separan con bastante facilidad, lo que se conoce como desnaturalización.La desnaturalización causada por el calentamiento se llama fusión del ADN. La temperatura a la que se desnaturaliza el 50% de la muestra de ADN se denominaderritiendo temperatura (Tmetro).

Determine la temperatura de fusión (Tm) para tres muestras de ADN

Enumere todos los factores que afectarían la Tm de una muestra de ADN de doble hélice

Recuerde que los pares de bases A: T tienen dos enlaces de hidrógeno y los pares de bases G: C tienen tres. Dado que todos los demás parámetros son iguales, el punto de fusión está determinado por el contenido de G: C del ADN (cuanto mayor es el contenido de G: C, mayor es la temperatura).

Un método muy simple para calcular la Tm teórica es asignar 20 C para cada par A: T y 4 0C para cada par G: C. La Tm es la suma de estos valores para todos los pares individuales en el ADN bicatenario.

Calcule el T teóricometro para el siguiente ADN

Cuando se representa el punto de fusión de diferentes moléculas de ADN frente al contenido de GC de la molécula y rsquos, se obtiene una línea como se muestra a continuación:

La ecuación lineal utilizada para calcular el punto de fusión de una molécula de ADN (0C, Na + 100 mM) es: Tm = 64,9 + 0,41 * (% GC) & ndash (500 / Número de pares de bases de ADN)

  • Usando la ecuación anterior, calcule el punto de fusión de una molécula de ADN que tiene 500 pb de largo y 50% de contenido de GC.

Los principales avances en la investigación de moléculas individuales han sido posibles con ADN marcado con fluorescencia. YO-PRO (la estructura que se muestra a continuación) es un tinte de oxazol que se une con el ADN de doble hebra a través del mecanismo de "intercalación" (inclusión reversible entre pares de bases). Recientemente, investigadores han informado que la temperatura de fusión de un ADN dúplex de 30 pares de bases aumentó en

20C por cada sitio de intercalación ocupado por el tinte YO-PRO.

  • Con base en la estructura de YO-PRO (que se muestra a continuación) proponer una explicación para el aumento de la temperatura de fusión (Tmetro).

Complejos de ADN-proteína

El ADN es enorme y debe almacenarse en el pequeño núcleo de una célula. En eucariotas, el almacenamiento de ADN se logra uniéndolo a pequeñas proteínas llamadas histonas.

¿Cuál es la carga total de la molécula de ADN? _______________

Dado que las histonas forman un enlace iónico con el ADN, predice qué carga esperaría ver en las cadenas laterales de las proteínas histonas.

Enumere algunos aminoácidos típicos que estarían involucrados.

Muestre un enlace iónico entre la histona y una hebra de ADN en la caricatura:

¿Esta unión dependería de la secuencia de pares de bases en el ADN?

Complejos de ADN-proteína

Las histonas se unen estrechamente al ADN evitando la transcripción.

Cuando llega el momento de transcribir el ADN (para producir una proteína necesaria), las histonas deben desenrollarse del ADN.

Las histonas pueden acetilarse: acetil (CH3Los grupos CO) están unidos a las aminas.

Problemas adicionales

El ADN tiene un surco mayor y menor. Para visualizar estos surcos, observe el ADN en este sitio: http://employees.csbsju.edu/hjakubow. NAtutorial.htm

Algunas proteínas se unen mediante enlaces de hidrógeno al ADN. Según el modelo, ¿dónde hay más donantes y aceptores de enlaces de hidrógeno?

Groove mayor Groove menor

Mire este modelo de una proteína que se une al ADN:

El ARN, a diferencia del ADN, usa ribosa en lugar de desoxirribosa y uracilo en lugar de timina como base.

Identifique claramente la (s) diferencia (s) en estas estructuras de azúcar.

Identifique claramente la (s) diferencia (s) en estas estructuras de bases nucleicas.

La estructura de timina y uracilo se muestra arriba. Dibuja la estructura de otra base que podría emparejarse con uracilo en un ARN corto

Ha visto cómo las drogas pueden unirse a través de IMF al "sitio quoactivo" de una proteína e inhibir la actividad de la proteína. Una nueva y revolucionaria forma de inhibir la actividad de las proteínas es unir una molécula a los ARN que se decodifican para formar una secuencia de proteínas determinada. Esto evita que se produzca la proteína. Si el & ldquodrug & rdquo es otro ARN, este método se llama Interferencia de ARN.

La línea superior a continuación es parte de una secuencia de ARN para una proteína en particular.

Plegamiento de ARN

El ARN monocatenario se puede plegar sobre sí mismo, como las proteínas, para formar estructuras complicadas y cotizadas. Éstos contienen regiones cortas de hélices "bicatenarias" ("estructura secundaria") estabilizadas por enlaces H intramoleculares.

Una estructura común que se encuentra en el ssRNA & ldquofolded & rdquo es un vástago / bucle de horquilla que se muestra a continuación.

Usando las abreviaturas de bases de ARN: A, G, C y U, agregue bases de ARN a la estructura de horquilla debajo, lo que permitiría que se formara una horquilla estable.

El bucle en el tallo / horquilla puede servir como lugar de reconocimiento de una proteína.

Dibuja una caricatura de una proteína que interactúa con un bucle de un ARN ss plegado que tiene 3 tramos diferentes de ARNdc.

Problema de aplicación de ARN

Cuanto más largo sea el ARN, más difícil será predecir las estructuras de tallo / horquilla, ya que muchas son posibles. Los programas de computadora pueden hacer esto por nosotros.

Vaya al servidor web mFold en http://mfold.rna.albany.edu/?q=mfold

Seleccione el enlace RNA Folding Form en la parte superior izquierda

Ingrese un nombre para la estructura de prueba (use Prueba)

Ingrese la siguiente secuencia de ARN monocatenario (enumerada en pares de tripletes para facilitar la entrada de datos):

GAG ACA UCC AUU GAU ACA CGG GUU UUA UUU AUC AAU GGA UGU CUC

Dejando todas las demás opciones en sus valores predeterminados, desplácese hacia abajo hasta la parte inferior y seleccione DOBLAR ARN

En la ventana de salida, seleccione para la Estructura 1 un archivo de imagen (jpg, png) e imprímalo.

Realice dos cambios diferentes en la estructura que aumentarían o disminuirían la estabilidad de la horquilla. Vuelva a ejecutar el análisis. Imprime ambos.

Se podría escribir una ecuación química para el plegado de ARN (tal como hicimos para la interconversión de formas de silla de ciclohexano sustituidas)

El & DeltaE para esta reacción se puede encontrar en la parte inferior del archivo de salida (dG = x). Utilice la siguiente fórmula (como hizo para la interconversión de sillas) para encontrar la Keq y el% doblado


¿Cuáles son los diferentes tipos de hélices en las estructuras secundarias de las proteínas y en qué se diferencian? - biología

Laboratorio de Computación Biología 2960

Secundario Las estructuras son estructuras ordenadas formadas por enlaces de hidrógeno internos entre residuos de aminoácidos. Las estructuras secundarias comunes son la & alpha-helix, la & beta-strand y varios bucles y giros. A continuación se proporciona más información sobre las estructuras secundarias.

Terciario La estructura de un polipéptido es la conformación tridimensional que forma regiones distintas, plegadas independientemente llamadas dominios. El dominio en la figura siguiente es el "bolsillo de unión al hemo" para la subunidad beta de la hemoglobina.

Un solo enlace de hidrógeno intrahelical no proporcionaría una estabilidad estructural apreciable, pero el efecto acumulativo de muchos enlaces de hidrógeno dentro de una hélice alfa estabiliza esta conformación. Los enlaces de hidrógeno entre los residuos de aminoácidos son especialmente estables en el interior hidrófobo de una proteína donde las moléculas de agua están ocluidas y, por lo tanto, no pueden competir por los enlaces de hidrógeno.

Las cadenas laterales de los aminoácidos en una hélice alfa apuntan hacia afuera desde el cilindro de la hélice. La estabilidad de una hélice alfa se ve afectada por la identidad de las cadenas laterales. Algunos residuos de aminoácidos se encuentran en conformaciones con más frecuencia que otros. Por ejemplo, la alanina tiene una pequeña cadena lateral sin carga y encaja bien en la conformación de hélice alfa y. Los residuos de alanina son frecuentes en las hélices alfa de todas las clases de proteínas. Por el contrario, la tirosina y la asparagina con sus cadenas laterales voluminosas son menos comunes en las hélices alfa. La glicina, cuya cadena lateral es un solo átomo de hidrógeno, desestabiliza las estructuras de hélice alfa ya que la rotación alrededor de su carbono alfa no está restringida. Por esta razón, muchas hélices comienzan o terminan con residuos de glicina. La prolina es el residuo menos común en una hélice alfa porque su cadena lateral cíclica rígida interrumpe la conformación helicoidal derecha. Además, la prolina carece de un átomo de hidrógeno en su nitrógeno amídico y no puede participar plenamente en el enlace de hidrógeno intrahelical. Por estas razones, los residuos de prolina se encuentran más a menudo en los extremos de las hélices alfa que en el interior.

    Hojas anti-paralelas y beta
    En la hoja antiparalela, los oxígenos de carbonilo de la cadena principal y los protones de amida de la cadena principal están perfectamente alineados para que formen enlaces de hidrógeno rectos. El oxígeno del carbonilo y el hidrógeno de la amida (protón) se colocan directamente frente a su compañero de enlace de hidrógeno. Las cadenas laterales apuntan perpendicularmente al plano de la hoja. La conformación antiparalela es una conformación más estable y más común.

Centro de aprendizaje de ciencias naturales
Universidad de Washington - Departamento de Biología
Copyright y copia 2011 Wilhelm S. Cruz
Reservados todos los derechos


¿Qué es un dominio en la estructura de las proteínas?

Un dominio en la estructura de una proteína es la estructura terciaria de una proteína. Además, se forma, existe y funciona independientemente de los otros componentes de la proteína. Aunque un motivo se forma a través de la interacción de elementos estructurales secundarios en una proteína, las interacciones que ocurren entre elementos estructurales secundarios son más fuertes en un dominio. Aquí, se pueden formar varios tipos de enlaces entre estos elementos estructurales secundarios. Fuera de eso, el principal tipo de enlaces formados son los puentes disulfuro. También son las interacciones más estables.

Figura 2: Tres dominios de piruvato quinasa

Además, también se pueden formar enlaces iónicos o puentes salinos entre los aminoácidos cargados positiva y negativamente en las estructuras secundarias. Además, se pueden formar enlaces de hidrógeno para estabilizar la estructura terciaria. Por otro lado, los dominios proteicos suelen tener una estructura globular y son solubles en agua. Además, un dominio de proteína realiza una función única de una proteína. Generalmente, se pueden identificar cuatro clases de dominios proteicos: dominios ll-α, dominios ll-β, dominios α + β y dominios α / β.


Información de soporte

S1 Fig. Histogramas de accesibilidades relativas a solventes (RSA) de hélices y hebras en las cuatro clases principales de SCOP.

Las hebras están significativamente más enterradas en todas las clases, pero la diferencia es particularmente grande en el caso de los dominios α / β. Esto puede deberse al hecho de que muchos dominios α / β, como los barriles TIM, están tipificados por un núcleo central de cadenas β rodeadas por hélices α accesibles al disolvente.

S2 Fig. Distribución de indeles en las clases SCOP.

La frecuencia de indeles aumenta con la disminución de la similitud de secuencia (paneles de la izquierda), y es mayor en las hélices que en las hebras en todos los dominios α y α + β, pero no en los dominios α / β (paneles de la derecha, usando alineaciones por pares con 10-20 % de similitud de secuencia).

S3 Fig. Las bobinas son menos robustas que las hélices o hebras.

Los paneles muestran datos obtenidos de alineaciones por pares con un 10-20% de similitud de secuencia, las estrellas indican una diferencia significativa entre hélices y hebras (p & lt 0.05 después de la corrección de Holm-Bonferroni). Si bien las bobinas son claramente las menos conservadas, la interpretación biológica de este patrón no es sencilla, porque en la gran mayoría de los casos las hélices y hebras cambian independientemente entre sí, mientras que las bobinas no cambian independientemente de las hélices o hebras: cuando una hebra o hélice cambios de residuos en una bobina, esto también se cuenta como un cambio en las bobinas. En consecuencia, la cantidad de cambio en las bobinas se acerca a la suma del cambio en hélices y hebras.

S4 Fig. Los residuos en las hélices alfa tienen más contactos que los residuos en las hebras beta, y las hebras tienen más contactos que las bobinas en las cuatro clases de SCOP (ANCOVA, p & lt 2E-16).

Las cajas representan intervalos del 25 al 75%, los bigotes del 10 al 90%.

S5 Fig. La mayor robustez de las hélices no es consecuencia de una composición de aminoácidos diferente, los aminoácidos individuales muestran la misma tendencia.

A) Dominios totalmente alfa frente a dominios totalmente beta. Los contenedores de RSA significativamente diferentes están marcados con estrellas. (Alineaciones por pares con similitud de secuencia del 10 al 20%, pruebas de proporciones, nivel de significancia 0.05, corregido para comparaciones múltiples con el método de Holm-Bonferroni). B) Dominios α / β. C) Dominios α + β.

S6 Fig. Los aminoácidos individuales tienen menos interacciones de residuos no covalentes en las hebras que en las hélices.

A) Regresiones entre RSA y el número de contactos para glicina, en hélices y hebras (p & lt 2e-16 en todas las clases SCOP, ANCOVA). B) La diferencia entre las intersecciones de los contactos-regresiones RSA para hélices y hebras. El efecto de la estructura secundaria sobre el número de contactos es cualitativamente el mismo en todos los aminoácidos: las hélices tienen un número significativamente mayor de contactos en todos los casos (p & lt 2e-16, ANCOVA).

S7 Fig. La relación entre la distancia de contacto promedio en la secuencia de la proteína (es decir, el número de aminoácidos que separan dos residuos con una interacción de residuos no covalentes en la estructura) y la robustez a las mutaciones, usando las comparaciones por pares con similitud de secuencia entre 10– 20%.

A) Todos los residuos B) Residuos de hélice con un número reducido de contactos y residuos de hebras con un número elevado de contactos (ver Fig. 3). Las estrellas indican una diferencia significativa entre hebras y hélices (pruebas de proporciones, p & lt 0.05, corregidas para comparaciones múltiples con el método de Holm-Bonferroni).

S8 Fig. RSA predice consistentemente el cambio de aminoácidos mejor que la densidad de contacto de residuos (CD).

El gráfico muestra un diagrama de dispersión de la importancia de RSA y CD, después del agrupamiento bivariado. Seleccionamos todas las alineaciones estructurales por pares de dominios SCOP con similitud de secuencia entre 45-55% (ver Fig. 1). Para cada alineación por pares, se determinaron RSA y CD para cada residuo y se realizó una regresión logística para determinar la relación entre el cambio de aminoácidos, RSA y CD. El cambio de aminoácidos se trató como una variable binaria: cuando los residuos alineados eran idénticos, la posición se asignó a 0, cuando no, 1. La función "varImp" del paquete "caret" R se utilizó para obtener la importancia relativa de los dos predictores. para cada regresión (en la escala de 0 a 100), que luego se trazaron y se agruparon en 2D con el paquete "hexbin" R, para mayor claridad. Si bien este enfoque es básico y no es adecuado para determinar las tasas exactas de cambio de aminoácidos, es suficiente para obtener una comparación cualitativa de la importancia de los dos predictores. En general, tanto RSA como CD predicen relativamente mal si un aminoácido cambiará o no, sin embargo, RSA supera consistentemente a CD.

S9 Fig. Las mutaciones puntuales que rompen la estructura secundaria se localizan con mayor frecuencia cerca de los extremos de las unidades de estructura secundaria.

S10 Fig. Las mutaciones sin sentido rompen las hélices con menos frecuencia que las hebras o espirales.

(* indica una diferencia significativa entre hélices y hebras, corregida para pruebas múltiples con el método Holm-Bonferroni (p & lt 0.05, pruebas de proporciones)

S11 Fig. El cambio de estructura secundaria se puede utilizar para mejorar las predicciones de patogenicidad de PolyPhen-2, incluso si no hay información estructural disponible para el tipo salvaje, solo datos pronosticados.

El patrón es cualitativamente similar a la figura 5C, pero las frecuencias de mutantes patógenos son más bajas, porque el PDB está sesgado hacia proteínas con mutaciones patógenas sin sentido: 50% de mutaciones patógenas humanas que pueden mapearse en una estructura determinada experimentalmente, pero solo 10% de las mutaciones neutrales. (Las barras de error representan intervalos de confianza del 95%, "*" representa significancia por debajo de 0.05 y "**" por debajo de 0.005 (pruebas de proporciones), controlado por tasa de descubrimiento falso con el método Benjamini-Hochberg).

S12 Fig. El efecto de las mutaciones sobre la energía libre de plegamiento (ddG) dentro de diferentes estructuras secundarias.

Las estrellas indican una diferencia significativa (*: p & lt 0.05 **: p & lt 0.005), después de la corrección por tasa de descubrimiento falso (con el método Benjamini-Hochberg). Dado que la gran mayoría de las mutaciones no dan como resultado un cambio de estructura secundaria, la estructura secundaria tiene solo un pequeño efecto sobre ddG, sin embargo, las mutaciones en las bobinas son consistentemente más desestabilizadoras que las mutaciones en hebras o hélices, excepto por los residuos más enterrados sin área expuesta al solvente. .

S13 Fig. El uso de la herramienta de comparación de proteínas RCSB (algoritmo CE) para realizar las alineaciones estructurales por pares da como resultado un patrón idéntico al de TMalign: las hélices cambian menos con el cambio de secuencia.

Los paneles muestran lo mismo que los paneles D-F en la figura 2, pero utilizando la herramienta de comparación de proteínas RCSB: alineaciones con una similitud de secuencia del 10-20%, con accesibilidad relativa al disolvente (RSA) como covariable.


¿Cuáles son los diferentes tipos de hélices en las estructuras secundarias de las proteínas y en qué se diferencian? - biología

Aminoácidos, polipéptidos y cadenas flexibles

Cada aminoácido lleva una cadena lateral (o grupo R) que, en teoría, puede tomar muchas formas químicas diferentes, pero solo 20-22 de estas formas se encuentran en proteínas comunes.

A pesar de sus diferencias químicas individuales, los aminoácidos (y sus grupos R) pueden clasificarse en cuatro "familias" diferentes dependiendo de si sus grupos R son:

Hay alrededor de 5 aminoácidos que son ácidos o básicos, y sus grupos R se ionizan a varios pH para producir una estructura química que tiene una carga positiva o negativa. Estos tipos de grupos R son fuertemente hidrófilos y se estabilizan cuando están rodeados de agua.

Hay alrededor de 10 aminoácidos no polares con grupos R que no son estables cuando están en contacto con el agua. Son hidrofóbicos.

Aproximadamente 5 aminoácidos tienen cadenas laterales polares, grupos R que no se ionizan ni se cargan positiva o negativamente. Estos grupos R no son ni fuertemente hidrófilos ni hidrófobos.

Los átomos de moléculas largas, como los polipéptidos, no están rígidamente fijados en el espacio o en la posición. Los enlaces covalentes que los mantienen unidos permiten que los átomos giren y tomen una posición tridimensional en la molécula donde son más estables. Esta propiedad de "rotación alrededor de un enlace" tiene consecuencias importantes para todas las demás propiedades de los polipéptidos y las proteínas.

Dado que la columna vertebral del polipéptido, unida por enlaces peptídicos, es flexible (debido a la "rotación alrededor de todos esos enlaces"), la cadena puede doblarse, retorcerse y flexionarse en una gran variedad de formas tridimensionales. Cuando están en agua, la mayoría de los polipéptidos se pliegan espontáneamente en una forma que es a la vez estable y crítica para el papel biológico que está a punto de desempeñar.

Las proteínas son moléculas muy grandes que ciertamente son lo suficientemente pesadas como para hundirse hasta el fondo de una célula si no se mantienen. Cuando un polipéptido se forma en el agua, por lo tanto, ¡no podría desempeñar ningún tipo de papel biológico si fuera arrastrado de inmediato, por gravedad, al fondo de la célula y dejándolo allí!

Sin embargo, debido a que el polipéptido es una cadena flexible, puede doblarse y retorcerse en casi cualquier forma. Esta forma no es aleatoria, sino el resultado de una serie de diferentes fuerzas inter e intramoleculares entre los grupos R internos, los enlaces peptídicos y el entorno acuoso externo.

Una de las fuerzas más importantes es la acción e interacción de los grupos R ácidos y básicos hidrófilos y el agua circundante. Cuando está en un ambiente acuoso, el polipéptido se dobla y retuerce hasta que el número máximo de grupos R hidrófilos se extienden hacia el agua donde son estables.

Esto tiene dos efectos sobre la macromolécula de polipéptido / proteína: comienza a dar a toda la molécula una forma característica y también proporciona un medio de soporte. Los grupos R hidrófilos que sobresalen de la superficie del polipéptido / proteína interactúan con las moléculas de agua y mantienen en suspensión la enorme macromolécula. Por tanto, la proteína no se "hunde" hasta el fondo de la célula.

Muchos de los grupos R que sobresalen de una cadena polipeptídica son hidrófobos o al menos no hidrófilos. Tener estas cadenas laterales rodeadas de agua desestabilizaría la molécula de proteína y la haría muy insoluble en agua.

Afortunadamente, las moléculas de polipéptido pueden reformarse a sí mismas de manera que eviten que esto suceda. Muchos o la mayoría de los grupos R hidrófobos eventualmente terminan mirando hacia el centro de la molécula, que es el punto más alejado del agua circundante. Al hacerlo, crean una zona o entorno que repele el agua fuertemente.

Así como las moléculas de lípidos o hidrocarburos se unen para formar una gota de aceite o grasa cuando se colocan en agua, lo mismo ocurre con los grupos R hidrófobos, con el mismo efecto que se excluye el agua y se estabiliza toda la estructura.

Muchas proteínas globulares, por lo tanto, tienen sus grupos R hidrófobos enterrados profundamente en su núcleo, creando una región de exclusión de agua que juega un papel importante en el mantenimiento de la estructura tridimensional general de la molécula de proteína final.

Un conjunto diferente de fuerzas actúa dentro de la propia molécula de polipéptido. Las fuerzas intramoleculares atraen o repelen partes de segmentos de la cadena de aminoácidos cuando los diversos grupos R se retuercen en proximidad entre sí.

La más fuerte de estas fuerzas intramoleculares es un enlace covalente que se forma, en las circunstancias adecuadas, entre los dos grupos R de dos aminoácidos de cisteína.

Muchas proteínas que son secretadas por las células, o que se encuentran en la superficie de las células, están "soldadas por puntos" en lugares a lo largo de su longitud mediante enlaces cruzados formados entre dos grupos R de aminoácidos que contienen azufre. Los puentes disulfuro (también llamados "enlaces disulfuro" o "enlaces -S-S-") se estabilizan fuertemente, particularmente si la proteína se va a transportar al exterior de la célula.

Se cree que este tipo de enlaces cruzados no son esenciales para crear la forma tridimensional de las proteínas, sino que se utilizan para mantenerlas en la forma correcta una vez que se han formado.

Se pueden usar agentes reductores químicos para romper estos enlaces cruzados, abriéndolos, sin alterar materialmente la forma general de la proteína.

Patrones plegables
Hoja beta-plisada

Aunque no es tan fuerte como un enlace -S-S- covalente, diferentes grupos R pueden entrar en estrecho contacto entre sí a lo largo de dos longitudes de la misma cadena polipeptídica. Un grupo R cargado positivamente será atraído por un grupo R cargado negativamente en una posición diferente en la cadena y la molécula completa se estabilizará un poquito más por su asociación cercana.

Sin embargo, es la disposición atómica dentro del propio enlace peptídico la que da lugar a una serie de otras posibles atracciones y, por tanto, a unir fuerzas dentro del polipéptido.

El átomo de oxígeno en el grupo carboxilo C = O tiene una ligera carga negativa (debido a la alta electronegatividad del átomo de oxígeno), mientras que el átomo de hidrógeno en el grupo amina (= N-H) de un enlace peptídico tiene una pequeña carga positiva.

Por lo tanto, es común y fácil que se forme una fuerza de atracción, llamada enlace de hidrógeno, entre dos enlaces peptídicos diferentes. Si bien los enlaces de hidrógeno son fuerzas de atracción muy débiles, si hay suficientes, pueden resultar mayores fuerzas de conformación.

Uno de ellos es la hoja beta plegada (o hoja beta), que se produce cuando dos longitudes de polipéptido corren en direcciones opuestas (antiparalelas) entre sí. Tal es el caso de una de las moléculas de anticuerpo y muchas proteínas globulares.

Una longitud de polipéptido se pliega sobre sí misma varias veces formando una disposición en "sándwich". Estas longitudes de cadena se mantienen entre sí mediante enlaces de hidrógeno que se forman entre enlaces peptídicos en longitudes opuestas. Esta hoja beta antiparalela rara vez es perfecta y, a menudo, está ligeramente retorcida y es menos regular que la forma ideal, ya que los grupos R de diferentes tamaños pueden distorsionar la molécula y no todos los enlaces peptídicos están involucrados en la formación de enlaces de hidrógeno.

Cuando se forman enlaces de hidrógeno entre enlaces peptídicos a lo largo de la misma longitud de cadena polipeptídica, se produce un tipo diferente de estructura intramolecular.

Esta es la hélice alfa, una espiral de polipéptido en forma de resorte que se forma en un cilindro rígido de gran regularidad. En este tipo de estructura, se forma un enlace de hidrógeno entre un aminoácido y uno cuatro aminoácidos más a lo largo de la cadena.

En una hélice alfa perfecta, por lo tanto, cada enlace peptídico está unido por hidrógeno a otros dos enlaces peptídicos en la longitud de la cadena, pero esto rara vez es el caso de las proteínas naturales. Cuando está rodeada de agua, una hélice alfa no suele ser estable, pero se encuentra en muchas proteínas transmembrana (las que atraviesan la bicapa lipídica de la membrana plasmática) donde el entorno hidrofóbico ayuda a estabilizar el cilindro de aminoácidos.

El plegado cambia las propiedades de la cadena polipeptídica en bruto, convirtiéndola en una forma tridimensional que tiene un papel biológico que desempeñar dentro de la célula y el organismo vivo. Cuando están completamente plegadas, las proteínas exhiben una increíble variedad de propiedades y una asombrosa versatilidad de función.

La propiedad de un polipéptido que determina todas las demás propiedades es la secuencia de aminoácidos a lo largo de su longitud. Esta es la estructura principal de la proteína que se produce al interpretar el código genético. Sin embargo, no hay nada dentro de la estructura primaria de una cadena polipeptídica que dé automáticamente a la proteína final sus propiedades biológicas.

Cuando las fuerzas intramoleculares, como los enlaces de hidrógeno, unen partes de la cadena polipeptídica en estructuras regulares que se repiten, como la hélice alfa o la hoja plegada beta, la cadena se acorta. Un polipéptido de 300 aminoácidos de longitud se acorta a aproximadamente la mitad de esa longitud cuando se pliega en una hélice alfa y menos del 10 por ciento de esa longitud cuando se pliega en una hoja con pliegues beta. Cuando se enrolla en una bola, el tamaño puede ser aún menor. Estas son las estructuras secundarias de la proteína final y son el primer nivel de plegamiento que producirá la forma de proteína definitiva.

Sin embargo, es raro que la forma de una proteína completa esté formada por una sola de estas estructuras secundarias. Es mucho más común que una longitud de polipéptido se pliegue en una región de hélice alfa, seguida de una región de caminata aleatoria sin patrón repetitivo, seguida de otra región de hélice alfa, y así sucesivamente.

Una proteína globular puede tener una región principal de hoja plegada beta, varias regiones de hélice alfa y varias más de caminata aleatoria entre su terminal N y su terminal C.

Estas regiones, o dominios, pueden considerarse como módulos de estructura secundaria dentro de la estructura tridimensional global final de la macromolécula de proteína.

La combinación de los dominios de la estructura secundaria con las fuerzas aún mayores de interacción con el agua circundante (hidrófila hacia el exterior, hidrófoba hacia el interior) produce una forma tridimensional, característica y completamente formada, o una estructura terciaria que a menudo es el nivel más alto de estructura alcanzada por muchas proteínas.

Es en este nivel de forma que las proteínas a menudo comienzan a mostrar sus propiedades biológicas y son capaces de llevar a cabo su función designada. La forma es muy importante para este papel biológico y si la proteína se ve forzada a adoptar una forma diferente, o se hace que pierda esa forma, entonces el papel y las propiedades de la proteína se pierden al mismo tiempo.

Este cambio de forma y pérdida de función se llama desnaturalización, y una proteína desnaturalizada suele ser inútil, lo que refuerza fuertemente la idea de que la forma es una propiedad crítica de todas las proteínas.

Un cuarto nivel de estructura, la estructura cuaternaria, se encuentra en proteínas muy grandes o proteínas muy complejas. Estos a menudo constan de más de una subunidad plegada (hecha de otros polipéptidos) y, a menudo, tienen adiciones no proteicas como lípidos, carbohidratos, polinucleótidos e incluso anillos heterocíclicos.

Esta jerarquía de niveles de estructura probablemente no tenga una relación obvia con el funcionamiento de la proteína, pero puede representar la progresión por la que tiene que pasar una célula para producir una proteína en pleno funcionamiento.


Ver el vídeo: Η τριλογία τής απόκλισης οι διαφορετικοί 34 (Noviembre 2022).